published on Monday, May 4, 2026 by fortinetdev
published on Monday, May 4, 2026 by fortinetdev
Configure IPv4 address groups.
This resource is a sub resource for variable
dynamic_mappingof resourcefortimanager.ObjectFirewallAddrgrp. Conflict and overwrite may occur if use both of them.
Create ObjectFirewallAddrgrpDynamicMapping Resource
Resources are created with functions called constructors. To learn more about declaring and configuring resources, see Resources.
Constructor syntax
new ObjectFirewallAddrgrpDynamicMapping(name: string, args: ObjectFirewallAddrgrpDynamicMappingArgs, opts?: CustomResourceOptions);@overload
def ObjectFirewallAddrgrpDynamicMapping(resource_name: str,
args: ObjectFirewallAddrgrpDynamicMappingInitArgs,
opts: Optional[ResourceOptions] = None)
@overload
def ObjectFirewallAddrgrpDynamicMapping(resource_name: str,
opts: Optional[ResourceOptions] = None,
addrgrp: Optional[str] = None,
exclude_member: Optional[str] = None,
_scopes: Optional[Sequence[ObjectFirewallAddrgrpDynamicMapping_ScopeArgs]] = None,
adom: Optional[str] = None,
allow_routing: Optional[str] = None,
category: Optional[str] = None,
color: Optional[float] = None,
comment: Optional[str] = None,
dynamic_sort_subtable: Optional[str] = None,
_image_base64: Optional[str] = None,
exclude: Optional[str] = None,
members: Optional[Sequence[str]] = None,
global_object: Optional[float] = None,
fabric_object: Optional[str] = None,
object_firewall_addrgrp_dynamic_mapping_id: Optional[str] = None,
scopetype: Optional[str] = None,
tags: Optional[str] = None,
type: Optional[str] = None,
update_if_exist: Optional[bool] = None,
uuid: Optional[str] = None,
visibility: Optional[str] = None)func NewObjectFirewallAddrgrpDynamicMapping(ctx *Context, name string, args ObjectFirewallAddrgrpDynamicMappingArgs, opts ...ResourceOption) (*ObjectFirewallAddrgrpDynamicMapping, error)public ObjectFirewallAddrgrpDynamicMapping(string name, ObjectFirewallAddrgrpDynamicMappingArgs args, CustomResourceOptions? opts = null)
public ObjectFirewallAddrgrpDynamicMapping(String name, ObjectFirewallAddrgrpDynamicMappingArgs args)
public ObjectFirewallAddrgrpDynamicMapping(String name, ObjectFirewallAddrgrpDynamicMappingArgs args, CustomResourceOptions options)
type: fortimanager:ObjectFirewallAddrgrpDynamicMapping
properties: # The arguments to resource properties.
options: # Bag of options to control resource's behavior.
resource "fortimanager_objectfirewalladdrgrpdynamicmapping" "name" {
# resource properties
}Parameters
- name string
- The unique name of the resource.
- args ObjectFirewallAddrgrpDynamicMappingArgs
- The arguments to resource properties.
- opts CustomResourceOptions
- Bag of options to control resource's behavior.
- resource_name str
- The unique name of the resource.
- args ObjectFirewallAddrgrpDynamicMappingInitArgs
- The arguments to resource properties.
- opts ResourceOptions
- Bag of options to control resource's behavior.
- ctx Context
- Context object for the current deployment.
- name string
- The unique name of the resource.
- args ObjectFirewallAddrgrpDynamicMappingArgs
- The arguments to resource properties.
- opts ResourceOption
- Bag of options to control resource's behavior.
- name string
- The unique name of the resource.
- args ObjectFirewallAddrgrpDynamicMappingArgs
- The arguments to resource properties.
- opts CustomResourceOptions
- Bag of options to control resource's behavior.
- name String
- The unique name of the resource.
- args ObjectFirewallAddrgrpDynamicMappingArgs
- The arguments to resource properties.
- options CustomResourceOptions
- Bag of options to control resource's behavior.
Constructor example
The following reference example uses placeholder values for all input properties.
var objectFirewallAddrgrpDynamicMappingResource = new Fortimanager.ObjectFirewallAddrgrpDynamicMapping("objectFirewallAddrgrpDynamicMappingResource", new()
{
Addrgrp = "string",
ExcludeMember = "string",
_scopes = new[]
{
new Fortimanager.Inputs.ObjectFirewallAddrgrpDynamicMapping_ScopeArgs
{
Name = "string",
Vdom = "string",
},
},
Adom = "string",
AllowRouting = "string",
Category = "string",
Color = 0,
Comment = "string",
DynamicSortSubtable = "string",
_imageBase64 = "string",
Exclude = "string",
Members = new[]
{
"string",
},
GlobalObject = 0,
FabricObject = "string",
ObjectFirewallAddrgrpDynamicMappingId = "string",
Scopetype = "string",
Tags = "string",
Type = "string",
UpdateIfExist = false,
Uuid = "string",
Visibility = "string",
});
example, err := fortimanager.NewObjectFirewallAddrgrpDynamicMapping(ctx, "objectFirewallAddrgrpDynamicMappingResource", &fortimanager.ObjectFirewallAddrgrpDynamicMappingArgs{
Addrgrp: pulumi.String("string"),
ExcludeMember: pulumi.String("string"),
_scopes: fortimanager.ObjectFirewallAddrgrpDynamicMapping_ScopeArray{
&fortimanager.ObjectFirewallAddrgrpDynamicMapping_ScopeArgs{
Name: pulumi.String("string"),
Vdom: pulumi.String("string"),
},
},
Adom: pulumi.String("string"),
AllowRouting: pulumi.String("string"),
Category: pulumi.String("string"),
Color: pulumi.Float64(0),
Comment: pulumi.String("string"),
DynamicSortSubtable: pulumi.String("string"),
_imageBase64: pulumi.String("string"),
Exclude: pulumi.String("string"),
Members: pulumi.StringArray{
pulumi.String("string"),
},
GlobalObject: pulumi.Float64(0),
FabricObject: pulumi.String("string"),
ObjectFirewallAddrgrpDynamicMappingId: pulumi.String("string"),
Scopetype: pulumi.String("string"),
Tags: pulumi.String("string"),
Type: pulumi.String("string"),
UpdateIfExist: pulumi.Bool(false),
Uuid: pulumi.String("string"),
Visibility: pulumi.String("string"),
})
resource "fortimanager_objectfirewalladdrgrpdynamicmapping" "objectFirewallAddrgrpDynamicMappingResource" {
addrgrp = "string"
exclude_member = "string"
_scopes {
name = "string"
vdom = "string"
}
adom = "string"
allow_routing = "string"
category = "string"
color = 0
comment = "string"
dynamic_sort_subtable = "string"
_image_base64 = "string"
exclude = "string"
members = ["string"]
global_object = 0
fabric_object = "string"
object_firewall_addrgrp_dynamic_mapping_id = "string"
scopetype = "string"
tags = "string"
type = "string"
update_if_exist = false
uuid = "string"
visibility = "string"
}
var objectFirewallAddrgrpDynamicMappingResource = new ObjectFirewallAddrgrpDynamicMapping("objectFirewallAddrgrpDynamicMappingResource", ObjectFirewallAddrgrpDynamicMappingArgs.builder()
.addrgrp("string")
.excludeMember("string")
._scopes(ObjectFirewallAddrgrpDynamicMapping_ScopeArgs.builder()
.name("string")
.vdom("string")
.build())
.adom("string")
.allowRouting("string")
.category("string")
.color(0.0)
.comment("string")
.dynamicSortSubtable("string")
._imageBase64("string")
.exclude("string")
.members("string")
.globalObject(0.0)
.fabricObject("string")
.objectFirewallAddrgrpDynamicMappingId("string")
.scopetype("string")
.tags("string")
.type("string")
.updateIfExist(false)
.uuid("string")
.visibility("string")
.build());
object_firewall_addrgrp_dynamic_mapping_resource = fortimanager.ObjectFirewallAddrgrpDynamicMapping("objectFirewallAddrgrpDynamicMappingResource",
addrgrp="string",
exclude_member="string",
_scopes=[{
"name": "string",
"vdom": "string",
}],
adom="string",
allow_routing="string",
category="string",
color=float(0),
comment="string",
dynamic_sort_subtable="string",
_image_base64="string",
exclude="string",
members=["string"],
global_object=float(0),
fabric_object="string",
object_firewall_addrgrp_dynamic_mapping_id="string",
scopetype="string",
tags="string",
type="string",
update_if_exist=False,
uuid="string",
visibility="string")
const objectFirewallAddrgrpDynamicMappingResource = new fortimanager.ObjectFirewallAddrgrpDynamicMapping("objectFirewallAddrgrpDynamicMappingResource", {
addrgrp: "string",
excludeMember: "string",
_scopes: [{
name: "string",
vdom: "string",
}],
adom: "string",
allowRouting: "string",
category: "string",
color: 0,
comment: "string",
dynamicSortSubtable: "string",
_imageBase64: "string",
exclude: "string",
members: ["string"],
globalObject: 0,
fabricObject: "string",
objectFirewallAddrgrpDynamicMappingId: "string",
scopetype: "string",
tags: "string",
type: "string",
updateIfExist: false,
uuid: "string",
visibility: "string",
});
type: fortimanager:ObjectFirewallAddrgrpDynamicMapping
properties:
_imageBase64: string
_scopes:
- name: string
vdom: string
addrgrp: string
adom: string
allowRouting: string
category: string
color: 0
comment: string
dynamicSortSubtable: string
exclude: string
excludeMember: string
fabricObject: string
globalObject: 0
members:
- string
objectFirewallAddrgrpDynamicMappingId: string
scopetype: string
tags: string
type: string
updateIfExist: false
uuid: string
visibility: string
ObjectFirewallAddrgrpDynamicMapping Resource Properties
To learn more about resource properties and how to use them, see Inputs and Outputs in the Architecture and Concepts docs.
Inputs
In Python, inputs that are objects can be passed either as argument classes or as dictionary literals.
The ObjectFirewallAddrgrpDynamicMapping resource accepts the following input properties:
- Addrgrp string
- Addrgrp.
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Allow
Routing string - Enable/disable use of this group in the static route configuration. Valid values:
disable,enable. - Category string
- Category. Valid values:
default,ztna-ems-tag,ztna-geo-tag. - Color double
- Color of icon on the GUI.
- Comment string
- Comment.
- Dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- Exclude string
- Enable/disable address exclusion. Valid values:
disable,enable. - Exclude
Member string - Address exclusion member.
- Fabric
Object string - Fabric-Object. Valid values:
disable,enable. - Global
Object double - Global-Object.
- Members List<string>
- Address objects contained within the group.
- Object
Firewall stringAddrgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - string
- Tags.
- Type string
- Type. Valid values:
default,array,folder. - Update
If boolExist - Uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- Visibility string
- Enable/disable address visibility in the GUI. Valid values:
disable,enable. - _
image stringBase64 - _Image-Base64.
- _
scopes List<ObjectFirewall Addrgrp Dynamic Mapping_Scope> - _Scope. The structure of
_scopeblock is documented below.
- Addrgrp string
- Addrgrp.
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Allow
Routing string - Enable/disable use of this group in the static route configuration. Valid values:
disable,enable. - Category string
- Category. Valid values:
default,ztna-ems-tag,ztna-geo-tag. - Color float64
- Color of icon on the GUI.
- Comment string
- Comment.
- Dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- Exclude string
- Enable/disable address exclusion. Valid values:
disable,enable. - Exclude
Member string - Address exclusion member.
- Fabric
Object string - Fabric-Object. Valid values:
disable,enable. - Global
Object float64 - Global-Object.
- Members []string
- Address objects contained within the group.
- Object
Firewall stringAddrgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - string
- Tags.
- Type string
- Type. Valid values:
default,array,folder. - Update
If boolExist - Uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- Visibility string
- Enable/disable address visibility in the GUI. Valid values:
disable,enable. - _
image stringBase64 - _Image-Base64.
- _
scopes []ObjectFirewall Addrgrp Dynamic Mapping_Scope Args - _Scope. The structure of
_scopeblock is documented below.
- addrgrp string
- Addrgrp.
- _
image_ stringbase64 - _Image-Base64.
- _
scopes list(object) - _Scope. The structure of
_scopeblock is documented below. - adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - allow_
routing string - Enable/disable use of this group in the static route configuration. Valid values:
disable,enable. - category string
- Category. Valid values:
default,ztna-ems-tag,ztna-geo-tag. - color number
- Color of icon on the GUI.
- comment string
- Comment.
- dynamic_
sort_ stringsubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- exclude string
- Enable/disable address exclusion. Valid values:
disable,enable. - exclude_
member string - Address exclusion member.
- fabric_
object string - Fabric-Object. Valid values:
disable,enable. - global_
object number - Global-Object.
- members list(string)
- Address objects contained within the group.
- object_
firewall_ stringaddrgrp_ dynamic_ mapping_ id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - string
- Tags.
- type string
- Type. Valid values:
default,array,folder. - update_
if_ boolexist - uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- visibility string
- Enable/disable address visibility in the GUI. Valid values:
disable,enable.
- addrgrp String
- Addrgrp.
- _
image StringBase64 - _Image-Base64.
- _
scopes List<ObjectFirewall Addrgrp Dynamic Mapping_Scope> - _Scope. The structure of
_scopeblock is documented below. - adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - allow
Routing String - Enable/disable use of this group in the static route configuration. Valid values:
disable,enable. - category String
- Category. Valid values:
default,ztna-ems-tag,ztna-geo-tag. - color Double
- Color of icon on the GUI.
- comment String
- Comment.
- dynamic
Sort StringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- exclude String
- Enable/disable address exclusion. Valid values:
disable,enable. - exclude
Member String - Address exclusion member.
- fabric
Object String - Fabric-Object. Valid values:
disable,enable. - global
Object Double - Global-Object.
- members List<String>
- Address objects contained within the group.
- object
Firewall StringAddrgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - String
- Tags.
- type String
- Type. Valid values:
default,array,folder. - update
If BooleanExist - uuid String
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- visibility String
- Enable/disable address visibility in the GUI. Valid values:
disable,enable.
- addrgrp string
- Addrgrp.
- _
image stringBase64 - _Image-Base64.
- _
scopes ObjectFirewall Addrgrp Dynamic Mapping_Scope[] - _Scope. The structure of
_scopeblock is documented below. - adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - allow
Routing string - Enable/disable use of this group in the static route configuration. Valid values:
disable,enable. - category string
- Category. Valid values:
default,ztna-ems-tag,ztna-geo-tag. - color number
- Color of icon on the GUI.
- comment string
- Comment.
- dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- exclude string
- Enable/disable address exclusion. Valid values:
disable,enable. - exclude
Member string - Address exclusion member.
- fabric
Object string - Fabric-Object. Valid values:
disable,enable. - global
Object number - Global-Object.
- members string[]
- Address objects contained within the group.
- object
Firewall stringAddrgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - string
- Tags.
- type string
- Type. Valid values:
default,array,folder. - update
If booleanExist - uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- visibility string
- Enable/disable address visibility in the GUI. Valid values:
disable,enable.
- addrgrp str
- Addrgrp.
- _
image_ strbase64 - _Image-Base64.
- _
scopes Sequence[ObjectFirewall Addrgrp Dynamic Mapping_Scope Args] - _Scope. The structure of
_scopeblock is documented below. - adom str
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - allow_
routing str - Enable/disable use of this group in the static route configuration. Valid values:
disable,enable. - category str
- Category. Valid values:
default,ztna-ems-tag,ztna-geo-tag. - color float
- Color of icon on the GUI.
- comment str
- Comment.
- dynamic_
sort_ strsubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- exclude str
- Enable/disable address exclusion. Valid values:
disable,enable. - exclude_
member str - Address exclusion member.
- fabric_
object str - Fabric-Object. Valid values:
disable,enable. - global_
object float - Global-Object.
- members Sequence[str]
- Address objects contained within the group.
- object_
firewall_ straddrgrp_ dynamic_ mapping_ id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype str
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - str
- Tags.
- type str
- Type. Valid values:
default,array,folder. - update_
if_ boolexist - uuid str
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- visibility str
- Enable/disable address visibility in the GUI. Valid values:
disable,enable.
- addrgrp String
- Addrgrp.
- _
image StringBase64 - _Image-Base64.
- _
scopes List<Property Map> - _Scope. The structure of
_scopeblock is documented below. - adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - allow
Routing String - Enable/disable use of this group in the static route configuration. Valid values:
disable,enable. - category String
- Category. Valid values:
default,ztna-ems-tag,ztna-geo-tag. - color Number
- Color of icon on the GUI.
- comment String
- Comment.
- dynamic
Sort StringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- exclude String
- Enable/disable address exclusion. Valid values:
disable,enable. - exclude
Member String - Address exclusion member.
- fabric
Object String - Fabric-Object. Valid values:
disable,enable. - global
Object Number - Global-Object.
- members List<String>
- Address objects contained within the group.
- object
Firewall StringAddrgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - String
- Tags.
- type String
- Type. Valid values:
default,array,folder. - update
If BooleanExist - uuid String
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- visibility String
- Enable/disable address visibility in the GUI. Valid values:
disable,enable.
Outputs
All input properties are implicitly available as output properties. Additionally, the ObjectFirewallAddrgrpDynamicMapping resource produces the following output properties:
- Id string
- The provider-assigned unique ID for this managed resource.
- Id string
- The provider-assigned unique ID for this managed resource.
- id string
- The provider-assigned unique ID for this managed resource.
- id String
- The provider-assigned unique ID for this managed resource.
- id string
- The provider-assigned unique ID for this managed resource.
- id str
- The provider-assigned unique ID for this managed resource.
- id String
- The provider-assigned unique ID for this managed resource.
Look up Existing ObjectFirewallAddrgrpDynamicMapping Resource
Get an existing ObjectFirewallAddrgrpDynamicMapping resource’s state with the given name, ID, and optional extra properties used to qualify the lookup.
public static get(name: string, id: Input<ID>, state?: ObjectFirewallAddrgrpDynamicMappingState, opts?: CustomResourceOptions): ObjectFirewallAddrgrpDynamicMapping@staticmethod
def get(resource_name: str,
id: str,
opts: Optional[ResourceOptions] = None,
_image_base64: Optional[str] = None,
_scopes: Optional[Sequence[ObjectFirewallAddrgrpDynamicMapping_ScopeArgs]] = None,
addrgrp: Optional[str] = None,
adom: Optional[str] = None,
allow_routing: Optional[str] = None,
category: Optional[str] = None,
color: Optional[float] = None,
comment: Optional[str] = None,
dynamic_sort_subtable: Optional[str] = None,
exclude: Optional[str] = None,
exclude_member: Optional[str] = None,
fabric_object: Optional[str] = None,
global_object: Optional[float] = None,
members: Optional[Sequence[str]] = None,
object_firewall_addrgrp_dynamic_mapping_id: Optional[str] = None,
scopetype: Optional[str] = None,
tags: Optional[str] = None,
type: Optional[str] = None,
update_if_exist: Optional[bool] = None,
uuid: Optional[str] = None,
visibility: Optional[str] = None) -> ObjectFirewallAddrgrpDynamicMappingfunc GetObjectFirewallAddrgrpDynamicMapping(ctx *Context, name string, id IDInput, state *ObjectFirewallAddrgrpDynamicMappingState, opts ...ResourceOption) (*ObjectFirewallAddrgrpDynamicMapping, error)public static ObjectFirewallAddrgrpDynamicMapping Get(string name, Input<string> id, ObjectFirewallAddrgrpDynamicMappingState? state, CustomResourceOptions? opts = null)public static ObjectFirewallAddrgrpDynamicMapping get(String name, Output<String> id, ObjectFirewallAddrgrpDynamicMappingState state, CustomResourceOptions options)resources: _: type: fortimanager:ObjectFirewallAddrgrpDynamicMapping get: id: ${id}import {
to = fortimanager_objectfirewalladdrgrpdynamicmapping.example
id = "${id}"
}
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- resource_name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- Addrgrp string
- Addrgrp.
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Allow
Routing string - Enable/disable use of this group in the static route configuration. Valid values:
disable,enable. - Category string
- Category. Valid values:
default,ztna-ems-tag,ztna-geo-tag. - Color double
- Color of icon on the GUI.
- Comment string
- Comment.
- Dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- Exclude string
- Enable/disable address exclusion. Valid values:
disable,enable. - Exclude
Member string - Address exclusion member.
- Fabric
Object string - Fabric-Object. Valid values:
disable,enable. - Global
Object double - Global-Object.
- Members List<string>
- Address objects contained within the group.
- Object
Firewall stringAddrgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - string
- Tags.
- Type string
- Type. Valid values:
default,array,folder. - Update
If boolExist - Uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- Visibility string
- Enable/disable address visibility in the GUI. Valid values:
disable,enable. - _
image stringBase64 - _Image-Base64.
- _
scopes List<ObjectFirewall Addrgrp Dynamic Mapping_Scope> - _Scope. The structure of
_scopeblock is documented below.
- Addrgrp string
- Addrgrp.
- Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Allow
Routing string - Enable/disable use of this group in the static route configuration. Valid values:
disable,enable. - Category string
- Category. Valid values:
default,ztna-ems-tag,ztna-geo-tag. - Color float64
- Color of icon on the GUI.
- Comment string
- Comment.
- Dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- Exclude string
- Enable/disable address exclusion. Valid values:
disable,enable. - Exclude
Member string - Address exclusion member.
- Fabric
Object string - Fabric-Object. Valid values:
disable,enable. - Global
Object float64 - Global-Object.
- Members []string
- Address objects contained within the group.
- Object
Firewall stringAddrgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - string
- Tags.
- Type string
- Type. Valid values:
default,array,folder. - Update
If boolExist - Uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- Visibility string
- Enable/disable address visibility in the GUI. Valid values:
disable,enable. - _
image stringBase64 - _Image-Base64.
- _
scopes []ObjectFirewall Addrgrp Dynamic Mapping_Scope Args - _Scope. The structure of
_scopeblock is documented below.
- _
image_ stringbase64 - _Image-Base64.
- _
scopes list(object) - _Scope. The structure of
_scopeblock is documented below. - addrgrp string
- Addrgrp.
- adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - allow_
routing string - Enable/disable use of this group in the static route configuration. Valid values:
disable,enable. - category string
- Category. Valid values:
default,ztna-ems-tag,ztna-geo-tag. - color number
- Color of icon on the GUI.
- comment string
- Comment.
- dynamic_
sort_ stringsubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- exclude string
- Enable/disable address exclusion. Valid values:
disable,enable. - exclude_
member string - Address exclusion member.
- fabric_
object string - Fabric-Object. Valid values:
disable,enable. - global_
object number - Global-Object.
- members list(string)
- Address objects contained within the group.
- object_
firewall_ stringaddrgrp_ dynamic_ mapping_ id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - string
- Tags.
- type string
- Type. Valid values:
default,array,folder. - update_
if_ boolexist - uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- visibility string
- Enable/disable address visibility in the GUI. Valid values:
disable,enable.
- _
image StringBase64 - _Image-Base64.
- _
scopes List<ObjectFirewall Addrgrp Dynamic Mapping_Scope> - _Scope. The structure of
_scopeblock is documented below. - addrgrp String
- Addrgrp.
- adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - allow
Routing String - Enable/disable use of this group in the static route configuration. Valid values:
disable,enable. - category String
- Category. Valid values:
default,ztna-ems-tag,ztna-geo-tag. - color Double
- Color of icon on the GUI.
- comment String
- Comment.
- dynamic
Sort StringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- exclude String
- Enable/disable address exclusion. Valid values:
disable,enable. - exclude
Member String - Address exclusion member.
- fabric
Object String - Fabric-Object. Valid values:
disable,enable. - global
Object Double - Global-Object.
- members List<String>
- Address objects contained within the group.
- object
Firewall StringAddrgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - String
- Tags.
- type String
- Type. Valid values:
default,array,folder. - update
If BooleanExist - uuid String
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- visibility String
- Enable/disable address visibility in the GUI. Valid values:
disable,enable.
- _
image stringBase64 - _Image-Base64.
- _
scopes ObjectFirewall Addrgrp Dynamic Mapping_Scope[] - _Scope. The structure of
_scopeblock is documented below. - addrgrp string
- Addrgrp.
- adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - allow
Routing string - Enable/disable use of this group in the static route configuration. Valid values:
disable,enable. - category string
- Category. Valid values:
default,ztna-ems-tag,ztna-geo-tag. - color number
- Color of icon on the GUI.
- comment string
- Comment.
- dynamic
Sort stringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- exclude string
- Enable/disable address exclusion. Valid values:
disable,enable. - exclude
Member string - Address exclusion member.
- fabric
Object string - Fabric-Object. Valid values:
disable,enable. - global
Object number - Global-Object.
- members string[]
- Address objects contained within the group.
- object
Firewall stringAddrgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - string
- Tags.
- type string
- Type. Valid values:
default,array,folder. - update
If booleanExist - uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- visibility string
- Enable/disable address visibility in the GUI. Valid values:
disable,enable.
- _
image_ strbase64 - _Image-Base64.
- _
scopes Sequence[ObjectFirewall Addrgrp Dynamic Mapping_Scope Args] - _Scope. The structure of
_scopeblock is documented below. - addrgrp str
- Addrgrp.
- adom str
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - allow_
routing str - Enable/disable use of this group in the static route configuration. Valid values:
disable,enable. - category str
- Category. Valid values:
default,ztna-ems-tag,ztna-geo-tag. - color float
- Color of icon on the GUI.
- comment str
- Comment.
- dynamic_
sort_ strsubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- exclude str
- Enable/disable address exclusion. Valid values:
disable,enable. - exclude_
member str - Address exclusion member.
- fabric_
object str - Fabric-Object. Valid values:
disable,enable. - global_
object float - Global-Object.
- members Sequence[str]
- Address objects contained within the group.
- object_
firewall_ straddrgrp_ dynamic_ mapping_ id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype str
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - str
- Tags.
- type str
- Type. Valid values:
default,array,folder. - update_
if_ boolexist - uuid str
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- visibility str
- Enable/disable address visibility in the GUI. Valid values:
disable,enable.
- _
image StringBase64 - _Image-Base64.
- _
scopes List<Property Map> - _Scope. The structure of
_scopeblock is documented below. - addrgrp String
- Addrgrp.
- adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - allow
Routing String - Enable/disable use of this group in the static route configuration. Valid values:
disable,enable. - category String
- Category. Valid values:
default,ztna-ems-tag,ztna-geo-tag. - color Number
- Color of icon on the GUI.
- comment String
- Comment.
- dynamic
Sort StringSubtable - true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
- exclude String
- Enable/disable address exclusion. Valid values:
disable,enable. - exclude
Member String - Address exclusion member.
- fabric
Object String - Fabric-Object. Valid values:
disable,enable. - global
Object Number - Global-Object.
- members List<String>
- Address objects contained within the group.
- object
Firewall StringAddrgrp Dynamic Mapping Id - an identifier for the resource with format "{{_scope.name}} {{_scope.vdom}}".
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom,global. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - String
- Tags.
- type String
- Type. Valid values:
default,array,folder. - update
If BooleanExist - uuid String
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- visibility String
- Enable/disable address visibility in the GUI. Valid values:
disable,enable.
Supporting Types
ObjectFirewallAddrgrpDynamicMapping_Scope, ObjectFirewallAddrgrpDynamicMapping_ScopeArgs
Import
ObjectFirewall AddrgrpDynamicMapping can be imported using any of these accepted formats:
Set import_options = [“addrgrp=YOUR_VALUE”] in the provider section.
$ export “FORTIMANAGER_IMPORT_TABLE”=“true”
$ pulumi import fortimanager:index/objectFirewallAddrgrpDynamicMapping:ObjectFirewallAddrgrpDynamicMapping labelname {{_scope.name}}.{{_scope.vdom}}
$ unset “FORTIMANAGER_IMPORT_TABLE”
-> Hint: The scopetype and adom for import will directly inherit the scopetype and adom configuration of the provider.
To learn more about importing existing cloud resources, see Importing resources.
Package Details
- Repository
- fortimanager fortinetdev/terraform-provider-fortimanager
- License
- Notes
- This Pulumi package is based on the
fortimanagerTerraform Provider.
published on Monday, May 4, 2026 by fortinetdev